PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P03290_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 776aa    MW: 83705.2 Da    PI: 6.4642
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P03290_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-21114169156
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             r++ +++t++q++eLe+lF+++++p+ ++r eL+++l L+ rqVk+WFqNrR+++k
  GSMUA_Achr11P03290_001 114 RKRYHRHTPQQIQELEALFKECPHPDDKQRMELSNRLCLEARQVKFWFQNRRTQMK 169
                             789999***********************************************998 PP

2START182.32.7e-573025241203
                             HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                   START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                             ela++a++elvk+a+ eep+W        + +n+de+++ f+   +     + +ea r+++v   +++ lve+l+d + +W  +++ 
  GSMUA_Achr11P03290_001 302 ELALAAMDELVKMAQMEEPLWIPGLeagsDALNYDEYYRCFSGCIGarptgFVSEATRETAVIVINSPALVETLMDAA-RWADMFPs 387
                             5899*****************98888899************66555999999**********9999999*********.******** PP

                             ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEE CS
                   START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgil 153
                                + +t++vissg      galqlm+aelq+lsplvp Rd+ f+R+++ l++g w++vdvSvd  +++    +  v++++lpSg++
  GSMUA_Achr11P03290_001 388 viaRTTTTDVISSGmggtrnGALQLMQAELQVLSPLVPvRDVSFLRFCKHLSEGAWAVVDVSVDGVRDNRPaPPATVKCRRLPSGCV 474
                             *99*************************************************************99999888999************ PP

                             EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
                   START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                             ++++sng+skvtwveh +++++++h l+r+l++sg a ga++wva lqrq
  GSMUA_Achr11P03290_001 475 VQDMSNGYSKVTWVEHSEYDEATVHPLYRPLLRSGSALGARRWVASLQRQ 524
                             ************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-20102169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-22103169IPR009057Homeodomain-like
PROSITE profilePS5007116.827111171IPR001356Homeobox domain
SMARTSM003897.9E-15112175IPR001356Homeobox domain
CDDcd000864.31E-18113169No hitNo description
PfamPF000468.8E-19114169IPR001356Homeobox domain
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
PROSITE profilePS5084841.315293530IPR002913START domain
CDDcd088752.57E-115299525No hitNo description
SuperFamilySSF559611.26E-30300525No hitNo description
PfamPF018522.8E-49302524IPR002913START domain
SMARTSM002345.1E-40302527IPR002913START domain
SuperFamilySSF559611.56E-20544742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MTFGGLFDDG SGGGVARLVA DIAYGGTADS VSHPRRLVSP SLHESMFASP GLSLALQTNL  60
GAHGERNLAR VGGVGGELDS VRRSKEDENE SRAGSDNFEG GSGDDLEQEH PRKRKRYHRH  120
TPQQIQELEA LFKECPHPDD KQRMELSNRL CLEARQVKFW FQNRRTQMKV FTHLERHENT  180
ILRQENDKLR AENLSIRDAM RNPICCNCGS PAVLGEISLE EQHLRIENAR LKDELDRVCA  240
LAGKFLGKPA SPLASPLPLP MLPNSSLELA VGTNGFAGLA QVVGAGATGA VDKAQERFVF  300
LELALAAMDE LVKMAQMEEP LWIPGLEAGS DALNYDEYYR CFSGCIGARP TGFVSEATRE  360
TAVIVINSPA LVETLMDAAR WADMFPSVIA RTTTTDVISS GMGGTRNGAL QLMQAELQVL  420
SPLVPVRDVS FLRFCKHLSE GAWAVVDVSV DGVRDNRPAP PATVKCRRLP SGCVVQDMSN  480
GYSKVTWVEH SEYDEATVHP LYRPLLRSGS ALGARRWVAS LQRQSLAVLV PPSLSPGGDS  540
TITPSGRRSM LKLAQRMTDN FCAGVCASSA REWSKLGGAI NIGEDVRVMT RQSVADPGVP  600
PGVVLSAATS VWLPASPQRL FDFLRNEQLR SQWDILSNGG PMQEIAHIAK GQNTGNAVSL  660
LRASAANATQ SSMLILQETC TDASGSLVVY APVDIPAMHL VMSGGDSAYV SLLPSGFAIL  720
PDGGTHKAPG SLLTVAFQIL VNSQPTAKLT VESVETVNNL ISCTVQKIKA ALHCET
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382297.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM0RP090.0M0RP09_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P03290_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein